dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|125975558|ref|YP_001039468.1| (Clostridium thermocellum ATCC 27405)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment cellulosome anchoring protein cohesin subunit [Clostridium thermocellum ATCC 27405]
Sequence length 688
Sequence
MKKNNVLTIAAMIALLLTSLLTSITFGETSSIPSRISMELDKTKANIGDIIIATIRIDNI
NNFSGYQLNIKYDPSYLQAVNPLTGEPIKKRTMPAVNGTVLLKGDQYSITEVVENNVDEG
ILNFGKGYANLTEYRKSGKPETTGIIGKIGFKALKLGKTEIKFENTPVMPGAKEGTLLFD
WDAETITEYNVIQPKELAITLPDDAHIALELDKTKVKVGDVIVATVKAKNMTSMAGIQVN
IKYDPEVLQAIDPATGKPFTKETLLVDPELLSNREYNPLLTAVNDINSGIINYASCYVYW
DSYRESGVSESTGIIGKVGFKVLKAANTTVKLEETRFTPNSIDGTLVIDWYGQQIVGYKV
IQPDKITVISEPEVPTQTPTQTPPTTTAPSQTPTQTPPTTTAPSQTPTQTPAVTPTQSAT
PSDPGGGGGGLPGGGGGAVNPSASPTPTPTSKPTPTATKKPEPTEIEEPEPEIPGTVGIH
YSYLTGYPDKMFRPEKSITRAEAAVIFAKLLGANENTKINYNVSYTDVDSSHWASWAIKF
VSYKKLFTGYPDGSFKPNQNITRAEFSTVVFKLLVSEKGLKEEKIEKSKFGDTKGHWAQQ
FIEQLSDLGYINGYPDGTFKPNNNIKRSESVALINRAMGRGPLHGAPQVFEDVPQTHWAF
KDIAEGVLNHRYKLDNEGKEQLLEIIDN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]