dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|346980504|ref|YP_004849448.1| (Clostridium thermocellum ATCC 27405)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Cthe_3339 [Clostridium thermocellum ATCC 27405]
Sequence length 73
Sequence
MKIIEDENSGEVVIDNIRIEGFIYDEKCKKCNNFLVYYEKYDAFFCAYCNEWVESKCRDK
ECEFCKSRPEKPL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]