dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|152964520|ref|YP_001360304.1| (Kineococcus radiotolerans SRS30216)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GntR family transcriptional regulator [Kineococcus radiotolerans SRS30216]
Sequence length 263
Sequence
MTQTDAARSRAGATPGTAGTGGPRVAAVTERLVTAIATGQYLPGSRLPPERDLAAALGAG
RMTVRAALAHLARRGLIETHRGRHGGSFVLQQWPDSSTEIVGRTLSATYAQLRDLCEAIA
RLHGAVCRAAAEHRSPADLERIGAALEAYAAAGSGLASQQADSALHLALIDAAHNDTLRR
VLADLEGQLSIGAPAHLWGAPEGMHAMEARALREHRDLVAAVAGRRADDAERIARAHVAI
DLELLSAALARTGALPAGTPTAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]