dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|378975684|ref|YP_005224295.1| (Treponema pallidum subsp. pallidum DAL-1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment P-ATPase superfamily P-type ATPase transporter [Treponema pallidum subsp. pallidum DAL-1]
Sequence length 792
Sequence
MQVSFVVHGISCTACVRRIEEAVRHVTGAYDVYVNPTTSHLYVHTDLHPTEHTLFAQTII
DAVSHAGFKATLLDTHSTTAPLAATQPVHPDFVTLKRRVRTSLCLLVPLMYLSMGHMVHL
PIPGFLHPLKYALSFALVQAFLTLPVLYANRSLFRAGLIALYGAILRRNTATMDSLISLG
SLSSFTYGLFATARIAMGVHANDTALVSHYVADLYFESAAMIVTLVTVGKYLSALSKGRT
SRALTQLLDIKPKTARVIRQVSVPRGASPSSPTTASAASAHETHEIEIEIPAQDVLVGDT
VLVKAGELVPVDGIITSGQATLDESNVTGESIPVEKGRGDSVISASLVSTGFLKFRAERV
GEHTTLAQIISLVEKTAASKVPVTKLVDAVSAYFVPSIVALSLLSGCAWLCAGASAEFAF
SIAVTVLVISCPCVLGLAVPTALMVATGKGAQMGILIKSAQVFQQMARTKVIAFDKTGTL
TLGRPTLSHIHTLHPTYNEEDILHLAYSLEVCSGHPLAAAISVAAQRKGMTPLAITDFNS
EQGLGLRARLVHTSYAKTVMVGNARMMVAHSIDGMDTYLSPSHNLEETPLFVAADKNLVG
VLFVSDPVKVHSSAAIGALHKRGIQTLMLTGDVKHVAHTIAARCGVKKSKAELLPHDKER
EISALKASGMMVAMVGDGVNDAPALASADVGIAIGAGSDIAVESADVVLMRNCIRDVVTL
VDLSIATVRNMKQNLFWAFFYNTLGVPLAAGLGYPFFGLRLTPMLAAAAMSLSSVSVLCN
ALRLNQFQSSSP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]