dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|241518293|ref|YP_002978921.1| (Rhizobium leguminosarum bv. trifolii WSM1325)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Rleg_5554 [Rhizobium leguminosarum bv. trifolii WSM1325]
Sequence length 159
Sequence
MRNCLGLLTAGVFLLQPCSFAKAQAPNALERAIGDVQPCRSLKTKVSSFGISVEVGVDKL
DSVKIENLQLSVNGDTAEASARGTLACKTSDEALVEGGFSATAEVRLKIDLSTCKTTDTS
IEIVKTGGRFGDVVKGLETQISGVLRQSLEKNLAKLCQK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]