dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|241195960|ref|YP_002969515.1| (Bifidobacterium animalis subsp. lactis DSM 10140)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment xylose isomerase [Bifidobacterium animalis subsp. lactis DSM 10140]
Sequence length 450
Sequence
MAGLWDIDKIEYVGRTKGLQEGLGFQYYDADKVVAGKKMKDWLRFGVAWWHTFDAPLTDP
FGDGTAQRPWDGKYSDPMDNALAKVDYAFEFFTKLGAEYFCFHDRDIAPEGDTLRETNAN
LDRVVDKIEENMQSTGVKLLWNTSSLFTNPRFVAGASTSPFADVYAYAAAQLKHSLEIGK
RLGAENYVFWGGREGYENLWVTDMKREQEHMAKFFHMCADYAKQIGMDAQFLIEPKAKEP
TTHQYDFDAATACNFLRAYDLIDVFKLNLEGNHANLAGHTYQHEIRVARDNGVLGSLDAN
QGDMLLGWDLDEFPTNLYETTSVMWEVLDEGQIGPHGGLNFDAKPRRTSFSAEDLFRAHI
AGMDSFAAGLLVADKMHQDKYIEDLVANRYGSYDSGIGKSIDDGTATLESLNDYAIDMPQ
SEIIASTHPDHLEDVKATINNYIIDALANA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]