dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|153938254|ref|YP_001392563.1| (Clostridium botulinum F str. Langeland)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment methyl-accepting chemotaxis protein [Clostridium botulinum F str. Langeland]
Sequence length 668
Sequence
MKSIKSKIVTIIAIVCIVSVALCSSISYYFSYKAIMTESTNKVSMASQKYSEMINGWLLT
KAKLMDSMVVDFQYNNKYDQKNIYSYFQSQLKDNKDVIGMYVGFEDKKFISGNGWIPTKD
YDCRQRDWYKEAVEKNGVIYSAPYIDKKFNSMVITVAKPIKKDGKIIGVVGMDVVVDYLK
TLVQKATPVKNSYGFLLDSNNDFIVHPNKEFQPKDEKMTNVNKIMDGKLKDLAQLDSSNN
KVLKSKDYDNKEKIFTRSKIPSSNWSVGFSVPVEEFKKPLNNIIIGFLSVIAISLAAAVI
FALYAGKKISDPILKITELVNETKDLDLTSRNNYETIALYKDETGIIGRAVIDLREELKN
IVEELKKSSKDVLKYSEIVNGATDETVQSIEAISTTVDELAKGSVDQAKDAQNGSEKLFS
LAEEIKITHNSTNLVKTYSLETKENSGKGILSMEETIDKFKENNRVNKELGKNVEMLSNK
SGSIGEIINSIQSIAEQTNLLALNAAIEAARAGEAGKGFAVVAEEIRKLAEQTSISTKEI
ENIVREIQFEIDNTKNNMDLSEKVVGEVNDAMKISKKSFDIITKSIVDIINQIEILVENV
NKVDSDKEEVLTSIQGISAIAEESAASTEEVSASVEEQTASMESISQTAKDLKEITSTLD
ELVNKFKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]