dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|124027145|ref|YP_001012465.1| (Hyperthermus butylicus DSM 5456)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment von Willebrand factor type A protein (vWA) [Hyperthermus butylicus DSM 5456]
Sequence length 263
Sequence
MAIPSTMLRVLKRRPLSYTVLVIFMLDRSLSMSELKTYDHRSKWEHLVELVERLLARLAR
SNMAPAFRVGFVWFSDDVKVVERGGAVYFPVTEHNPALRVFQESTEENRPYGMTAMADAL
EHAAMIIERYIEDTSIPSEKYVTVFMFTDGKETKRTPEDVVEVADRITGELQEKLRALNQ
RNRIGLATIALGLDADRETLRTIASFLREAQRRVLEERGLIDLVDPPYHEKMFIDAPRND
KITREWEEAVRRFVERLSETAIF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]