dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|159037549|ref|YP_001536802.1| (Salinispora arenicola CNS-205)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment bifunctional DNA primase/polymerase [Salinispora arenicola CNS-205]
Sequence length 377
Sequence
MAARWLGASKILGRPVASNDPYPHICGRLLPAERAHSHRPVLLQRRDCAACAHGRHQRRR
ATPDIPPAVMERTRTMSDNPLLNAALGHAARGWRVFPLRPDDKRPAFPDHPADDCTGRDP
RCRNAGCHLGWEPRATTDPDRIRRAWTARPYGIGLACGPSHLVVVDLDVPKDDSGGGPSG
TDTLAALASQHGASIDATYTVTTGRGGTHLYYRHPDGGPDLRNTAGTLGPMVDTRAHGGY
VVAAGSTAAGRPYTVSLDTDPAPLPAWLAGLLAPAPLPPQRPVVVELPGGRERSYVRAAV
ERECASVTGAPDHHNDALYFASIALGQLVAGGSLSADEASTALEHAGLSVGLRHRAVLAT
IASGFRAGTRRPRTVAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]