dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|156938088|ref|YP_001435884.1| (Ignicoccus hospitalis KIN4/I)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tryptophanyl-tRNA synthetase [Ignicoccus hospitalis KIN4/I]
Sequence length 379
Sequence
MNGDLQKSTDYDRLIKVFGVTPLSEEVLNKLPERHKLFEIGYFFAHRDFDKVLEGWERGE
EFAILTGRGPSNVMHLGHMLLFDFVAWMQKTFKVPAYIPLSDDEKYVFLKVDSLREAAFY
AYDNALDIAALGFDEKKTYFFISTKTPEIYEMSVELSTEVTLNEVKAVFGFTDSDNPGKY
FYSVVQSAHILFPTVRKGYRSLVPIAIDQDPYIRLSRDIAERKKLPKPAALHSKYLPGLT
GEPMSASKPETAIFLDDPPKVIKEKIWKALTGGQPTVKEQREKGGDPERCVVFKWLEAFV
LDPKEAEEWKGRCRRGEVLCGECKKKLYEGIVRILKEHHERKLKLADKADKFFLHPVDWG
EVDKVKEKTKRLLEQFNLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]