dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|282164730|ref|YP_003357115.1| (Methanocella paludicola SANAE)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein MCP_2060 [Methanocella paludicola SANAE]
Sequence length 334
Sequence
MGDWTAALNGYPIDWLLEEDNPSVRYFTLTGLLQKPVNDPEVVSAKRSLMMNGLIPSILA
KQEAAGYWGMPEDFYVRSKYKGTVWTLILLAHLGADGSDPRIKKACEYILDYSQDRESGG
FSYRRFRGAAYRDGLLPCLTGNMAWCLIRFGYLDDPRVQRSIEWITQYQRFDDGDGSPSG
WPYGKHEACWGRHTCHYGVVKALKALAEIPPRKRSKPVKATIEAGAEYLLKHRIYKSSHD
PEKVTMPGWLKFSFPRMWSTDALEVLGILARLGYRDERMQDAIDAVLEKQDAQGRWLNED
RYGSRYIMRVDRTGRPSRWVTYEALHTLKLLKFP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]