dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|269125902|ref|YP_003299272.1| (Thermomonospora curvata DSM 43183)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Tcur_1658 [Thermomonospora curvata DSM 43183]
Sequence length 304
Sequence
MVRNPEDLYELSGDLPEMTGPVMLYCLDGFVDAGSVGQLVREHLLNSLEHRVIARFDADS
LIDYRARRPPMTFDRDRWLDYQAPELVVHLLRDEAGTPFLFLTGPEPDRQWEAFAAAVRS
LVERLGVRLSVTFHGIPMGVPHTRPVGLTMHATRPELVNRVSFFDRVQVPGSAAALLEYR
LGQAGHDVIGYAVHVPHYLAQAAYPTAAVAALDAVIGCTGLVLPSDALREASVRTETEIA
EQVAGNDEVEKVVRALEQQYDAFTGATGRQSLLAEEAEMPTAEELGAQFERFLAQQRRAD
GSDT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]