dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|161527940|ref|YP_001581766.1| (Nitrosopumilus maritimus SCM1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment exosome complex exonuclease 1 [Nitrosopumilus maritimus SCM1]
Sequence length 244
Sequence
MGGREATMVLMDENGKRCDGRTVDEPRRIMIKAGGLKNADGSSYIEFGDNKILVGVFGPR
DVHPKHMSDTDTGILRVRYHMEPFSVGERKNPAPSRREIEISKVIKEALEPAVMLEKFPR
TAVDVFIEVLQADGGTRCAALTAASVALADAGIPMRDMVAAIAAGKVADTVILDVNNEED
QAGQADMPIGYMPNLEKITLLQLDGVLTPEEYKKCIQVGVDGCKLVYELQKKALNDKYFG
NKGD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]