dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|157826859|ref|YP_001495923.1| (Rickettsia bellii OSU 85-389)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Sec7 domain-containing protein [Rickettsia bellii OSU 85-389]
Sequence length 658
Sequence
MDPLIKREVISSFNDKPKDGINKIKEWCASNNKDFAEETAKFFREEKNNLDLVAVGDYLG
TDGEDNKKVLDHFVKQFDFKDKNYLKSLREFLKAFKLPGEAQKIDRLVESFASKYYEQNT
TTDINHADAAFISAYATVGLNTNLHNPSVKDKWTIDQFKDQLKGLNAESKLQGIKSGKNF
SNEFLENIYNGIKAEPFELNFIQTATGYEIAGISSQNDKTFKKLDDFLTAKTDINNVFSN
LGNNVTAQHKQPKTWLNKFTGYEGSVSVKAGNAEVEIQVYKPNILSKWFLGEKSKLVIQP
KGGSEQSLKLAAQIAASFETKVTSIKATYDYLKQDLENYYNNPEQELRKANLVVDLHNKI
KETTAKVQQADPEIPDTKSIPLASETNFQDLKEAEVGIQPAKTQPVEKPKFNTLVEELAW
RNAQKKQAIDTPVTKNEEPKAQIDNHKKRLEELKQKQEDLENKKKELEEKKANSNITKEE
KWRIVAELEGVTKHLESIKKEHNTINTAEEREKQFNKSSQSSALKGEPTAADKQQQAAME
LIRLRKQRLQEEAASKAIIANNPATQPLKPGVIPPPPPPPPGKGVPIPPPPPPPMPGQGV
PIPPPPPPPPPPMPAIPPKLQETLKTIQTTQDGNKQQGNNNFQDDLRKTLARRNSPTR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]