dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|161614657|ref|YP_001588622.1| (Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment N-acetylneuraminic acid mutarotase [Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7]
Sequence length 382
Sequence
MKNFKKMMTLMALCLSVAITTSGYATTLPDIPEPLKNGTGAIDNNGVIYVGLGTAGTSWY
KIDLKKQHKDWERIKSFPGGAREQSVSVFLNDELYVFGGVGKKNSESPLQVYSDVYKYSP
VKNTWQKVDTISPVGLTGHTGVKLNETMVLITGGVNEHIFDKYFIDIAAAAADESEKNKV
IYNYFNKPAKDYFFNKIVFIYNAKENTWKNAGELPDAGTAGSSSVMENNFLMLINGELKP
GLRTDVIYRAMWDNDKLTWLKNSQLPPSPGEQQQEGLAGAFSGYSHGVLLVGGGANFPGA
KQNYTNGKFYSHEGINKKWRDEVYGLVNGHWQYMGKMKQPLGYGVSVSYGDEVFLIGGEN
AKGKPVSSVTSFTMRDGNLLIK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]