dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|290960007|ref|YP_003491189.1| (Streptomyces scabiei 87.22)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein SCAB_56211 [Streptomyces scabiei 87.22]
Sequence length 281
Sequence
MTQPTPLRRALALAAHGVPALPLRAGKAPFGNCPTCAGNACGGRPNMKTPGPCTCPRPCH
GWAAATTDAYVLTSPPWAPAWRRAAAVAYHPGGAGVTVVDLDNAAAVDWARATLPTTRTV
PTTRGEHWTYRGVMRSVNGVREGVDIKSTMSYTRWLGPGVGATAALPDAVRALAVREPFP
SRRAPQALTVPPRGGQGECPHRTPTYLDRGVAMAEQRITEARSAVHATVYRTFLAVLSTH
GRCGCLTDTHVNRLFTAAQAKGESVRHCTDAWSNALTTLGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]