dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|284992024|ref|YP_003410578.1| (Geodermatophilus obscurus DSM 43160)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GntR family transcriptional regulator [Geodermatophilus obscurus DSM 43160]
Sequence length 238
Sequence
MTADSRAEGTEEVSKADQVHRQLRTEIELGELAPGTPLSELSLVGRTGASRTPVREALRR
LAAEGLVDLVPRQGARVSRVSARSVRDLFEFRSLLEPAAVRQATEAAATDPALHRTFAEL
REAIAGVLERDPSTARSRSFYELADRFDWAVIGATRNEHLRRTIAELRPHTARLRNLSHL
DPQRVEVSVGEHLAVCDALLAGDADGAATALAGHLTRSLETIFRNLAHGPGEGVDLLG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]