dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|169830304|ref|YP_001716286.1| (Candidatus Desulforudis audaxviator MP104C)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment tRNA(Ile)-lysidine synthetase [Candidatus Desulforudis audaxviator MP104C]
Sequence length 470
Sequence
MDLQDRVQQYILRHRMLEPGMGVLVGVSGGPDSVALLDVLYGLRAVLGISITVAHLNHRL
RGAEAEADARYVRKLAEKFGLPCIVEECDVPTFRKAERLSIQTAARELRYEFFARAARET
GARRVALGHHADDQAETILHHFLRGTGPAGLAGIAPVRGLFIRPLLGIRRREIEAYCRAR
GLDPRLDPSNLDPVYTRNRLRAELLPLLETEYNPNLVTALLRLGEICRAENDYMEEQTET
IFRRSAAPTDGCVRLDADRVAALPPAIGRRMIRRAWSELAGDPGALDFDHVERVLELARA
AAGGKRLDLPRGIRVERQFAALVFSLGPDPAEYGAWHYVLVVPGRTELPEVGLLITTDIR
PAEQAWRPETLQPGQAAVDLDTLTLPLVVRNRRPGDVFWPQGAGGRMKLKEFLINNKVLR
PERDRIPLVFDGEGRLVWVAGYRIAEFCKLTPGTRSVLLLTVSEPGPGVV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]