dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|158334273|ref|YP_001515445.1| (Acaryochloris marina MBIC11017)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hemagglutination activity domain-containing protein [Acaryochloris marina MBIC11017]
Sequence length 959
Sequence
MLPLRLLAPHPLQAQIIPDQTLPINSQVTANGNNIFIEGGTTAGNNLFHSFEEFSLTNTN
QATFNSVPAIDNIIGRVTGNSISNIDGVIKVNSNANLLFLNSNGIIFGPNSSLDIGGSFL
ASTAVGVQFQDGSVLSTANPQPPPLLTISRPTGLLFNGTQSGRIMVRGTLALPPSQTLAL
VGRNVQFNGGTAIVESGRIEVGSVSRGSVTLSPSAIGWNLKYNQVQAFSDIQLLSESALL
NPNVVSNPFGGIQIQGRHIRLNQSEVRAQTLADQPGADINVQASQSLEIGGEVDSFFPFS
SWIATVVERGAQGKGGRIRVDAPNLSIRDGGRIQTLSIGNGRSGNVLINADTLFLSGAAS
PTVNTRREFGNNLNTRISSENFGPGEGGRIDVNTGSLTLLDGGRITTVVGPFTLGNGGDI
AVNASQFIFAKEVNPFAIDSVSNISTITFGFGDAGNVNVSTQRLHLVNGAQISTRGIKIS
FGNQGFTPGAGNVGNVTVKADQAITVTGASQLAPDFISFLGSITNGTGKGGDVSILTQNL
TVEDGGSLSSAVFSSSINSGPLPPNIGEGNGGNLTIDAAKVNVIGINNSPFNPSPSILGT
FTLGPGNAGNTTINTQHLKVLEGGQINTGTLASGNAGRLFINATKSVLVKGRATNNLPAQ
IASNTLVLNEATRNAFFLPSQPTGNTGEVTIQSQHITLADGGRIGVQHIGSGNAGGLSIT
ADSVLLNNQGAIIAETASGEGGNLNLTVKDILQLRNNSLISTESEGLGNGGNININTQFL
IASPFENSDIIANAFDGDGGNITISTQGIFGFASRDTVTPFSDITASSQQGINGVIEINS
PEVDPSQSLVELPAVVPPLENIVQGCRPGQTLGGSSFTHIGRGGLPSGPGRYLTPHTVWQ
DLRPNHSAHLSAVHDHPNNSAIVKPPIQIVEAKGWTQDAQGRIYLTAQTTSSRPHGTGC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]