dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|166366917|ref|YP_001659190.1| (Microcystis aeruginosa NIES-843)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein MAE_41760 [Microcystis aeruginosa NIES-843]
Sequence length 1212
Sequence
MLWDNGILSSVASINQIGSLSILGASHKYLYTSLINSGTISQNISGYTLFLNQSANINNS
GIYEFQAGEIRNAPNSVGVFNNSGTFRKTSSGLSIVSVPFYNTGTVNVELGTLLLLGGGS
SNGGIFNISSGGTLEIKSSSSLTNNTYFLDSNAQINGTGTLMISGGFLELARDWAFPTTT
INILWSAGIKSSGTVTNPGSLTIQNSAYLYASLNNTGTITHLILRRSSPGTVSSLSLNQS
ANINNSGIYEFQSGELDNEIRNAPNSVGVFNNSGTFRKTNAGTAIVSVPFYNTGTVNVEL
GTLLLLGGGRSNGGIFNISRFGTLELKSAGATLTNNTYLLDSNTQINGTGTLMISGGFLE
LDSDWTLPTTTINILRNAGIKSPGTITNAAGLTIQGNAYLYASLNNTGTIVQNLVLSNPS
DRLSLNQSANINNSGIYEFQAGEIRNQVDSIGVFNNSGTFRKTSSGLSIVSVPFYNTGTV
NVELGTLLLLGGGRSNGGIFNISRFGTLELKSAGATLTNNTYLLDSNTQINGTGTLMISG
GFLELDSDWTLPTTTINILRNAGIKSPGTITNAAGLTIQGNAYLYASLNNTGTIVQNLVL
SNPSDRLSLNQSANINNSGIYEFQAGEIRNQVDSIGVFNNSGTFRKTSSGLSIVSVPFYN
TGTIESVMGTVSFYNSYTHNNANLILKSGNVSFTNPLTINGGNIEGNGNINATITNSGLL
NPRYVSNTEFGRLTINGNYTETNNASINIQLGGNTAAVNFDQIDINGTANFDGTLNVSLL
NGFTPTLGSTFDVLTYDALNSLSNLDFTGLDINSTLQFLPQWSSNKLTLKVVDKSAPILA
IAPTNVVESESHSGTKPFTFTVTRSVNTTGTNNVNWAVTVTGSGSNPANATDFAGGLLPS
GVVSFAAGETSKVITVNVQGDTTVEPNETFRVTLSNPTNGATITTATAIGTIQNDDFIGT
SGPDTLAGTSGADAMTGLAGNDTYTVNNAGDLVIEALNQGTDTVQAAISYTLPNNVENLL
LTGTGNLNGTGNALNNQITGNSGNNNLNGAAGTDTLIGGTGNDSLNGAAGIDTLTGGVGT
DIFIFQFSQSTSAALDRVTDFAIGDDKIDLLSQAGGAINAPVAFTRAANSTTTNINTIVT
NVFTDANGATAGNQALGTNSAALVRDNSSSTYLIINDGTAGFQSANDLVINLTGLTGAFP
ALGTIAVNSFFV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]