dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|166367965|ref|YP_001660238.1| (Microcystis aeruginosa NIES-843)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein MAE_52240 [Microcystis aeruginosa NIES-843]
Sequence length 910
Sequence
MKTTQVSSDLSSTDMSSLADFLSFDGAFPITFDLTGSDDLTVSKETSPLGVLNSNPSPSI
VSSEAPTVSASPANDRTAVSNFASNTFTLADSFPRTLISSQPTHDQQDDVSKLFRDGWIG
QDHSPQLFSSLHGGDSKASGPCTCSQCSLPPVDPRRIVPEAETLNKLPLPSLDLTKTFSL
NSLPGANHTIYLDFNGHTTTGTLWNTAFGKSSIVTPTFDLDGSPASFSTTELERIQYIWQ
RVVEDFSPFNVNVTTQEPTLDRLIKSGTTDTAWGVRVAIGGSSYDWFGAGAGGVAYVGSF
NWNSDTPTFVFSTQTLSDEKYTAEAISHEVGHTLGLKHDGRTTPSEAYYLGHGAGETGWA
PIMGAGYYQNLTQWSKGQYLAANNTEDDLAIITTQNGFGYRVDDKGNTLATASTLTVFGT
AVSSSGIIERNTDVDFFSFTTAAGPISLTVTPSNRGPNLDILAELYNASGVLVASSNPAD
FLAASISANVGAGTYYLKVDGVGKGDPLGTGYTDYGSLGQYAITGSIIRGTISIAKTTDG
NEAGSVSSVFTLTRTGDLSSALTVNYTLGGTATPGVDYTGTTPSSVTFAALSPTATITLP
TKDDLLSDPGETITTTITAPVGYTISGPDNATATILDNDGNAANDNLVGTGFADALAGVG
GNDTLSGLGGNDTLDGGADNDTYLFNTDLVLGSDLLIDALGTDTLNFAATTTKTINLNLG
STAAQTVTAGNLTLTLARATAFENVIGGSLNDTILGNSLVNSLTGGAGNDSLTGGLGKDI
LTGSDGLDTLNYNSLGESLLTGFDVIQGYNGTGASLDSINAPAPIAPITLTASKGTASSL
TEAAIQLVLTNAAFAANTAAAFTLDPLANPNYANDTFIALNNGVAGFQAANDAIIQLSGY
KIAVAPVLVI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]