dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|269925506|ref|YP_003322129.1| (Thermobaculum terrenum ATCC BAA-798)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine/threonine phosphoprotein phosphatase [Thermobaculum terrenum ATCC BAA-798]
Sequence length 269
Sequence
MTCSWKYAFASVIGTYHLSRGLPCQDAIRVSLCRLEKEDVLLAVVSDGAGSAARGDEGSE
FACQFFVEKLHDFVLSGSEICTLDRELCVGWVKDYLSHLEERANSCEAQISDYASTLLAA
VVGSRSAVFLQIGDGAIVASTEDDPDSYTAIFWPQKGEYESTTFFLTDNNSHENLLILSL
DDVSICDLAIFTDGLQRIALDFTENEAYNPFFRGMFNPLRGQFDGYLQELSEQLKNFLGS
PRVNEYTEDDKTLLLASRVIGQQLSEVPD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]