dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428777972|ref|YP_007169759.1| (Halothece sp. PCC 7418)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment filamentous hemagglutinin family outer membrane protein [Halothece sp. PCC 7418]
Sequence length 1569
Sequence
MRAFPSKIDLVLRQTSLSLLLLIIAPFFGIVSTKDAKAQRIIPAEDGTGTEIQDPIATPD
GRQQINIDGGTVSGENLFHSFEQFGLDASEIANFLSDPAIANILSRVTSGDPSIINGLLR
VSGGNSNLFLMNPAGIIFGPNAQLDLTGSFAATTATGIEFENGIFGAVGANEYSALIGNP
TAFRFEQDLASPIINAGDLAVIEGETLSLTGGSVVNTGSLTAPGGNISIAVVPGESRVRI
TQEGRILSLEVPIPQGGNGEPIAIQPLDLPQLLTVGEGIETGLNINDGSVETESGVVIPQ
DESAIVPGELNATSGQANLLADSNLFINTEVIIDGDLTLNSQENVLIGANIISQADNETT
LEVQANRNISVFGDAIESQSSPFNVILNSDRDGNNSGGIVINPGSQINSNGGEIVLGGGT
TPRETPAVGSEELINGVQMQGTLKSGGGDITIRGTGFAGADNQESSPIGVDIQNGDPENP
AQILAEGGNLTVMGRGGEGIGSNLRGVNIEEGSVISSIDDGTIIIEGTGGNGSDGNTGLF
LGNASEITTENGDIELLGQGSLSATSSDNRGLNIQGESQITASGIGNVILEGTGGNGINN
NIGIFLDNATIQTETGDIQGIGKGGLEATGNGNDGIFIFQESQLISSEGEVRLEARGGTN
NSDSIEVISALFDAPLTLQTANGAINGTIEGENEITLNALDEEGIIELSADISTSSGAIT
INDAIVLSDDQTLTGDGITFKETVDSDSLESPRSLTLDTTDNGSTTFEESVGGEIPLNNL
ETNADGQTNLNGGEVNTTNNQIYNDPVILGADTTLNGNNITLNDTVDSNENTQQDLTVES
SGTTTFGDRVGSKTPLDQLVTDANGETNLNGREVNTINNQTYNDPVTLGENTSIKGSNIT
FDADIDTNDEGIGLRIDAEQSLITEKIETNGGDVSLNADTEILTGAIVTNGGNVRLANTE
TISDARQETPRNPEDNNDIEVTYIDTEGGDVTVITERFFRVTETIDGNVSISSVGGGSVT
INHGGDTNNPFIVGEPDLNNGTVGDITNLDFTIEEGVFPFTELEGNIGLISTRESDPDIT
NPDITNPETNPKSNIDGETAVNSDPTQLTPVSLTASRTILSNIEKESGVKAAVIYVRFTS
VVEPIGNGETLESEPSGSLAAELAANSQTNTVPEEEASSLFEELEAESLTPYANYYPGIK
ASPSVVSAPQSTDQMEIVIVTADNEVTRTIVPNIKREAFKEVGLKLREEVLLNQYPGIVR
LQKMRNKTHLEPAQILYNWMIKPVENQLEAQEIENLVFVLPSEFRLIPLATLHDGEQYLV
QKGYSVGLAPALSMINGQYKKVQQAELLAMGTSEFPEIEGAILENELPAVPIELEEVVDD
WGGVKFEGDQFSINQFNAVRRRNPYGIIHLATHANFTEFSPGSSYIRFYDDVLKLDQINQ
LNLKDVELLTLSACRTVFGDQNSELGFAGLAYRAGVKSVLGSLWQIDDAGTLAFMTQFYD
QLDDENVAIKAEAVRQTQVQMIEGRIRIEGQQIITETEMINLPPESAPVQIDLSHPYFWS
GFTIVGSPW

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]