dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|170761902|ref|YP_001752546.1| (Ureaplasma parvum serovar 3 str. ATCC 27815)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GTPase ObgE [Ureaplasma parvum serovar 3 str. ATCC 27815]
Sequence length 435
Sequence
MAFIDKCKIVLIAGNGGDGIVSWRRETHVPEGGPAGGNGGNGGSIWFVGNHNETSLEFLK
YKKIIRAKHGEKGDIKNQHGANAEDVFINVPLGTVVYNPITNEILADINIDQQKYLVAQG
GLGGHGNTHFKSPFNKAPNLYELGELGENVEVLLELKTIADIGIIGLPNAGKSTLISTFT
NAKPKTANYMFTTLNPVLGTIYRDQNRIIFADIPGLIEGAHTGVGLGHDFLKHIERCFLL
IHLISLDPNDNPDIINAYETIVNELKQYKQNLVNKPIVLVANKIDQIGALENLQILKEYL
KNNQEIKIISALTNLHVDNMLDDVIKIYFAQKKIYEQRLKEQLPVDQILKWTSDIPKSKE
LDKTIEIIKVDDHIFEVFGEYLKYWAHRIPLKTQDNLIRFNQKLQSINFNQQLLQAGAVA
GDSIKIYDITLEFEE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]