dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|291301221|ref|YP_003512499.1| (Stackebrandtia nassauensis DSM 44728)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Snas_3749 [Stackebrandtia nassauensis DSM 44728]
Sequence length 301
Sequence
MPNGEDLYTVEADTPDISGAVMLVELRGFMDAGQAGQGVTEYLLKELDHQVVASFDVDEL
IDYRGRRPVMTFDTDHWVDYDAPRLRVYLMRDDVGVPFLLLSGDEPDLRWERFAEAVQSL
IEKFGIRLTVALHGIPMGAPHTRPLGVTAHGTDASLLPSGERTLNRLQVPGNAAALLELR
LGQAGHDAIGFAVHVPHYLAQASYPNASVRLLESLHQATGLSVSVESLREEGRVVDAEVD
SQVRASQEVSDVVAALERQYDMFDDSRPSLLVEESEEELPTGDELGEQFERFLAEQQRRS
E

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]