dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|288559770|ref|YP_003423256.1| (Methanobrevibacter ruminantium M1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment anti-sigma factor antagonist [Methanobrevibacter ruminantium M1]
Sequence length 99
Sequence
MELIKNYNEKELTIETGNKIDTTTAPDFENEIMDEMGNFDSLTLDLKNLEYISSAGLRVL
ILVQKKLKADDIPFVIINTNDNIKNILTMSGFDKILNIQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]