dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|193213992|ref|YP_001995191.1| (Chloroherpeton thalassium ATCC 35110)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein Ctha_0273 [Chloroherpeton thalassium ATCC 35110]
Sequence length 172
Sequence
MTSFEQILIAIQADILTRLGERLQPLPLALKRTADEVLLENETWTDADGLVIVRYAGSTY
GQVTAPGLTLQERELLFDVSVLCQNLTGENPEDLALGYVGQVITALAGFVPTDCTDALRV
VRDEFAQADAAAHKFHYRIRFACPALLIQTYDTEELHLLKTTDIQDLTIAST

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]