dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|410661527|ref|YP_006913898.1| (Dehalobacter sp. CF)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Transcription antitermination protein NusG [Dehalobacter sp. CF]
Sequence length 175
Sequence
MTKNWYVIHTYSGYENKVKTNLEKRVESMNMEDKIFRVLVPMEDEIEIKNGKKKISKRKV
FPGYVLVEMDMTDDSWYVVRNTPGVTGFVGSGSKPIPLLDQEVAVILRQMGLEKIRTKID
VVVGQSVRVISGPFKDFIGVVKEVLEEKQKVRVSVSMFGRETPVELEFGQVEKLD

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]