dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427734675|ref|YP_007054219.1| (Rivularia sp. PCC 7116)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment serine/threonine protein phosphatase [Rivularia sp. PCC 7116]
Sequence length 809
Sequence
MENDAATLYCPNELCQAANPLTHKFCQRCSTPLPKRYLWAVADNSIVGNSGELLQERYLI
IEHNVLLDTKPGILPQMPEQQKLDDIKSYLRLIPYRLHVPQVYGMLSVNTGNTSEEILIL
EKPPLVLNELPTKVQLCGELTDAWKGANSLRQLNWLWQIAQLWQPLASVGVASSLLAKKL
LRAEGSIVRLLELSSDRESKPSLLALGKFWQQELLPKAQSTIRNFMGEVCRLLVEEQIHS
SEQLIAVLDNGLTSLGKCSKIDIRVFALTDTGPSRQRNEDSCYPQSGTTVSKPPSKSALT
IVCDGIGGHEGGDIASKTAIETIEQSLTQLASLPKDRIHPAVLLADLERAAAIANDKISQ
LNDSENRQGRQRMGTTVVMALPLGHEMYISHVGDSRAYLITQNNCHQVTLDDDVASREVR
LGYAVYRDAVAQAASGSLVQALGMNASSALHPTAQRFILDEDCVFLLCSDGLSDFDRVEQ
YWEAEILPLLKNSSDVVSVTKQLLEIANNQNGHDNVTIASMHCQTKYSEPKSALETTLAD
ISSISVTDSSHLAPVRQNLPNQKTQVITKKANIKGFNLPLILGIIALLTIAGGSLGYFWR
QGIIRSKSEPREVAQTENIPPKIAEPTFETNSQRIAQIDKGWLISAKAKLNLSKSTLPPA
DNNSSARRQPLPIFAPPASLLQVVQKQQISSSQDYWLQIKVCSVGDVEAAINSATATTGS
RTLLKPGEQVWLNSSQLTPSNVSISNPANKTSQCTQAETLAPKIEDSSTSVPVEDSLIPS
QPSIPSKPDSLSGSTTLPQTGNSTDSKTR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]