dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|427738421|ref|YP_007057965.1| (Rivularia sp. PCC 7116)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment filamentous hemagglutinin family domain-containing protein [Rivularia sp. PCC 7116]
Sequence length 1609
Sequence
MGANWQYSNKKLCFSVPLITAIALTFSANTVVAQVTPDQSQGKENSVVTPVNPNTERIDG
GAVRGSNLFHSFKEFNVGERQRVDFASPTGVENIFSRVTGNNSSNIFGTLGVLGNANLFL
LNPNGIIFGPNARLDIRGSFVASTGKGVNFEDRILFGANNLESKPLLTMAVPVGLQYGTQ
QAGNINNEGNLQVGEGQKLALAGNTVTTSGKMTAPGGTVHVLGERVGLLDNAQIDVSGET
GGGNVLIGGDFQGKGEVPNAKRTFVGSGANIIADALTSGDGGRVIVWADETTGFNGNISA
RGGSQFGNGGFAEVSGKENLAFQGKVDLSANNGQFGSLLLDPTNITIVEGGNNPSELAAN
NEFADSGVNNTIKNSTINAATANVILQASNDITFDAPVNIAANGVELTAEANNNINVNAN
ITSNRGNVTLDADKDNSGAGSLIITNAAINTNGGDFAGSGKGSNASTSGINLTNSEINAA
GGNIQVIGRGKDGGSDGKGINIDGINGNSVIETTGAGNITLTGTSGAGSCAVGLECRNHG
IFVGNSQVKTENGKIRFIGKGASSNGDVNHGIAIWSGGLVESTGTGAIDMTSTTEAKTNN
NVYGNDAISVVGGGIVKTITGDITMTGIGGNDGGETDGNQGIVVLDPNSKVTSVSGDISL
AGTGRGVGDNHYGIWIGRGNGGEVTSENGNITLNGKGGGTGKNNIGVYLNESGLVKTTGE
GNITLDGTSGTGSCSENCENHGIKIFNDSKVSSKDGKISFIGKGASSNGDINHGVYILLN
GLVESTGAGSIEMTGTTEATASTSNNSVGNEGISIVGGGKVISEAGNITMTGTGGNGESE
MNGNQGILVLDPNSEITSVSGDISLTGTARGIGSNNHGIWIGDRTGIEQENNGKITSENG
NITLIGQGGGTNVKNIGIFLDGNGVVSTVGTGKIVLNGTGGNGTNENHGILVQGNSKVSS
VNGDIDFSGKGGGNATDGSKNNGISIFNRGVVETTGTGRIVLNGIVSNENDNNAGIRIQD
LGSQIFSSGGGDINLVAESISLIDDGQVRASTINATDAVKKGGDILVNASDTLEVLNGGR
LRSQTSGTSNAGNITIDTSKLDVRYSQSDPFQITGIGTDTRPESSGDGGNLSINATESVT
ISGNDPTPFNPSPTVGNLILAASTRTGITASTLGSGKAGNLIINTKRLTIQDDAGAATAS
LSLKENAEDGGVLTVNATESIELKNLAGLATATIGSGNAGNLIVNSGQINLTGGAVFSAD
TFNSGKGGNLIITTNELNVLSGSRIGAATVGEGSGGNIKVNTLENKAQLVKVDGVSANGE
VSSSLTASSQEGGKAGDLNISTKGLEVLNGGQIAVSSTGENSISGNMLLTADSLLLKNQA
SINALTSTQGEGGDININVANNIDFEGRDSEISSEAFGNASGGNLTIDVGKFIKSSGIPN
NNDIVVTADGRGVGGKLSAKAKGDYGFVNFDKVRTPDSDFTAASRLGQDGTLSLITDNPE
PQLPQQPNTPEIVQVCPSSQGVTTRTAGRSEFINTGHGGLPPSPNEALESNTAQVPWVTL
NPQENKPTTASKPKVIREAQGWVKMPNGKLLLTTRKSNSSSSSCVFQSN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]