dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GS_23802 (Ascaris suum Victoria/Ghent )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment GS_23802 GS_23802
Sequence length 677
Sequence
MVLNNNDKPNELNRCHNWSTFVESQSVEVAKSADFRSLDSRESFDKRAIEMMRCPCGIGH
NNNAHRNCVRAGKVYPYAMSGTKYAAKAFKGMNDAQRYEHHYYDTPANEMCGSEDIQKGG
MNDEGEHERIFTSCAYFNASSSVRYANDVKIRRSCVANGNERKHRSADYGATVTVDGGTT
RNVADMDGLAALTSKTALCRGFPSEDNRSITVATPVRYSPATFSSPPPAGERVAVYERKE
TGNLLQSKRDAVTRDPVATSTPVDGSPPTMVHSVGDSPSRMLNRSGISTITASTICDPNF
EQDYVAEIKRLNEGILIQEERLSQAIVALAHAKNFSSNYGTLAELCAHRELLLCRERHAV
FHRELERVKMLHLIKKRIPQLSPKMQSTFEVLSIVVHLNRNFSIRSSGERDAYAFLALLK
AADQVDATEAVTPIGGRTMRVNTVQFNGRILFTNMPLDFTVTVEIYALKMYETKRQDDRH
CAVLKNKAKSLLNPNICVGKQSMNDESVVSSSEFTLCGRVLLNRDTVGTQRFYLENVEYP
LEGTIELKSSCTPVPAIIETGFNGFLTMYEVVSDLASWVRYWAVLRRGVVRFWKYPDDEA
AEKTAIADMDLTKCTNVKVKPASFEVCFHPNAFCVDLLLSTRPSVVEKKRVLLSADTKEQ
CVAWIDAINETLALLRG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]