dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSADVT00006595001 (Adineta vaga)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep supercontig:AMS_PRJEB1171_v1:HG380778:718477:720352:-1 gene:GSADVG00006595001 transcript:GSADVT00006595001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 430
Sequence
MDKSIVRKSSRALETGKIFSPRLSERGKHHESQTEFHHGSKIEQKIQNLRLRMHGHLLPP
EVPVVEPLKPMRYVRHFNVSVSLKRSRLLSRPNSDLKQWSIGRRQFNENPKQGIQWLVEN
NLLQNTPESVATFLFNETGLSKRAIGEYLGEKDDFHIDVLKHFARRHDFFTVDIVEALRR
YLFAFLLPGEAQKIDRIMEAFSKRYYECNPDIFVNAEVCFILSYAIIMLNTSLHNKSARM
GGPFTYEKFLSSLTEAISQQHMPDSTTLKNIYDHIKNNEFKFPDDGDIDIMNVSMRIKEG
GSTIIKEGWLWKQGGLVRNWKRRWFVITDGCLFYYESRTEVDNPRGIVSLIDVGVREIED
DRPKQFCFELFPLAGEKVKSTKPVSGEIGKVTEGHHTVYRMSAPSDDERKEWIRALRIGT
QNELPKQRLS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]