dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

GSADVT00032204001 (Adineta vaga)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep supercontig:AMS_PRJEB1171_v1:HG380907:148002:149115:1 gene:GSADVG00032204001 transcript:GSADVT00032204001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 259
Sequence
MSTYFVCKNGQQVLWTSVCDGHNQCLDGSDEHNCYCQGDVYACLQGNNVSCRIACPTYGR
VTCLTYRNTLACEQYLRERSSTSNSDIHSAGDLSLSSNNFDALRYSALLAGGILLFVSLI
SLLIYVIRKHPQVLFFCSNKSSNTNSNRKSTHRLTLESAVLQQHQLTPSTNLSRPRYTPA
PDINDLPPSYYATRNPVSINDCYEPPPYPGPPLISSIQRTDSVYYETIKTPSTSNSMSML
HPMPLPEPRAFANARTHRV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]