dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Bra019218 (Brassica rapa Chiifu-401 1.2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 913
Sequence
MANRNGESSSSQPPQFQPQQQNANEQDPEHHSGNADPRSRGGNTAVLAVEAIISPPSVSF
SNLCYFDCLQKQEFRSSFLEGLGWTSWKKRWFILTRTSLVFFRSDPSAVQQRGGEVNLTL
GGIDLNSSGSVVVKADKKLLTVLFPDGRDGRAFTLKADTMEDLHEWKAALEHALTQAPSA
SHVMGQNGIFRNDQSDAPAGVDEHRDEAPARPTVLGRPVLLALEDVDGTPSFLEKALRFV
EDHGVNTEGILRRAADVDDVEHRIREYEQGKNEFSPTEDAHVIADCLKYFLRELPSSPVP
ASCCNALLEACRTLRGNRVNAMREAICESFPEPNRRLLQRILMMMQLVASNKNVNRMNTN
AVAACMAPLLLRPLLAGDCNIENDFDVGGDGSMQLLQAAAAANHAQAIVITLLEEYESIF
GEGSLSAGLYSDSEESGSETEEGTDDGDYDDEDYDGTQGSDDYTDEEEGFENESDRSYSE
SEASAETPHDHKARPSIQITEITSSESTPKGSTQPKVPKKLLSSSKRSSLPRHEHARKDE
NILVKGSDSAQVKAVLGVSKAEDKNSSTTLSSAPGGSKRLWGRAHGRKNLSMESIDFTLE
VDEDDADIERLESTKSELQNRIADEVKNNAVLQASLERRKKALYVRRQALENDVERLQEQ
LQQEIDRKSALESGLNMSKGNQTIPETTDEKLKKDLQEVAQAEADIVNLEHKVDDLENRL
GQQDVKGSGSPHGGSRESRRSPEHNSKMKEKQKDTEAASGNVLQDGQGSARENEIEKIQD
PRSKSSQQTSKVAGMSKRSGTKGEGNTTTTTSALSKLTMRLNFLKERRSQIANELSNMDK
GKSSSGQPSPSTEQNRSVQETERETGSKSNQNQDSDSSKLQSPHVLDRGRSDNGGDRGKG
GNQPSTTPRTLSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]