dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|530280467|ref|YP_007982538.2| (Helicobacter pylori UM037)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment hypothetical protein K750_05945 [Helicobacter pylori UM037]
Sequence length 134
Sequence
MMRVVVFDASGSLEAFDYRGVLIHTQEIQANEKVKLPFTQKNFFKFNGVSFGVCEGVGDL
DYKDYPKNLNFNALSIETIENYLLNAKEPQNTQQKALLTDFLEVYNKNIEKGFIYLKPRF
FLEKEKQLIERILK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]