dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jgi|Catan1|124324|e_gw1.73.33.1 (Catenaria anguillulae PL171 v1.0)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 292
Sequence
MTYTPRPVNPANTLEHRVFLEKDGKPVSIFHDVPLYANAEKTVFNMIVEIPRWSNAKLEI
SKEDYLNPIKQDVKKGKLRYVRNCFPHHGYIWNYGAFPQTWEDPNHVHPDTKAKGDNDPL
DVCEIGERVGYTGQVKQVKVLGVMALLDEGETDWKVIVIDVTDPLADKLNDIEDVERHLP
GLLRATNEWFRIYKIPDGKPENVFAFSGEAKNKAYALEVVHETHEAWKRLVNGQAPKNDI
SVANVSVAGTPGQIATASDSAYNSIPAATHSPAGPIDPSVDKWFFISSSPNL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]