dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSGMOP00000006232 (Gadus morhua 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1039:38189:42672:1 gene:ENSGMOG00000005864 transcript:ENSGMOT00000006413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 452
Sequence
FNELRLEGKLCDVVLEVEGLQFKAHKNILCGCSPYFRVLFTHNMSPMTGVYPIPGVSADT
MQLLIEYAYTRHVEVTWDNVEALLVAADYLSVMGAVRACCGFLGGQLSVENAVGIWRLTN
HYPLPRLRRRAYLYILRCFEEVARVSEEFPELSLEQLGDLLGEDTLNAAQEEVVFEALLR
WISHAHEERRGHISQLLLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMG
GYDGHTRLSSLERYQPEENQWTPLASMHEQRSDASATSLHDKVYICGGYNGSMCLQSSEC
YDPRTDQWTLITPMGVQRSGVGVVAYKDHVYA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]