dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSGMOP00000019640 (Gadus morhua 76_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1811:138:54381:-1 gene:ENSGMOG00000018206 transcript:ENSGMOT00000020119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 2715
Sequence
MMSNNYDDQLPPQYSQEFGDEEDDEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVSK
NINDLQRDFGDGLKLISLLEVLSQKKMYRKHHIRPNFRQMKLENVSVALEFLDREHIKLV
SIDSKAIVDGNLKLILGMIWTLILHYSISMPMWEDEEDEDAKKLTPKQRLLGWIQNKVPQ
LPIKNFHRDWNDGKALGALVDNCAPGLCPGWADWDPNQPVENAREAMQQADDWLGVPQVI
APEEIVDPNVDELSVMTYLSQFPKAKLKPGAPLKNKQLFPDKAKAFGPGIEPHGNTVLQP
AVFTVDTQEAGSGEVLVYVEDPEGYKEEAKVKPVKNKSGTYTVTYTPKVEGVHRVKVLFA
GQDIDKSPYTVNVTKTMGDASKVHARGPGLDATGNVANKPTYFDIYTAGAGNGDVSVVVI
DPQGKKDTVELVLENKGDSVFRCTYRPVLQGPHVIHVLFAGQEIPKSPFTVNIAEAMNPS
ICRATGRGLQPKGVRMKEVADFRVFTKGAGPGELQVSVKGPGDTEEKVNVREVGDGVYEC
DYVPLKPGKYTVTITWGGQPIPRSPFVVEVGLEAGFQKVRAWGPGLKTGMVGKSADFVVE
AIGTEVGTLGFSIEGPSQAKIECDDRGDGSCDVRYWPTEAGDYAVHVICDDEDIKDSPFM
AHILPAANDVFPEKVKAFGPGLRPTGVVVNKPTEFTIDARMAGKGHLKIYAQDAQGCTID
IQINEKGDGTFLCVYTPSKPIKHTIIVSWGDVNVPNSPFRVLVGEGCHPDKVKVYGPGVE
KSGLKANEPTYFTVDCGDAGQLGDISIGIKCAPGVVGPAEADIDFDIIKNDNDTFTVKYT
PPGAGRYTIMVLFADQEIPVSPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGAPTHFTIYT
KGAGKARPEVHFAVSGAGEAVRDFEIIDNHDYSFTVKYTALQQGNMAISVTHGGDPIPKG
PFHISVAPALDLSKIKVEGLDTKVEVGKDQEFTVNSQGAGGQGNVGVKMTSPSGRPIPCK
TESDKAGGTHGVKYIPPEEGQYKVEVSYDGHPVAGSPFGVEGVMPGDPSKVRAYGPGLKG
GIVGKPAFFTIDTLGAGAGGLGLAVEGPCEAKLECRDNGDGTCSVTYLPPVVGEYDINIL
FAEQHVPGSPFKAVVRPAFDPAKVTAYGPGLERARAGEQASFTVDCSRAGEAELTIEIVS
ESGAKAEVRVQKTAEGTFSVSYTPPFHGAHTITVKYGGGVIPQCPKVIQVEPAVDTSGVK
VYGPGVEPRGVLREVTTHFIVDTRALSKAGGGRIKVHVINPSGGSTETFVTDKGDTYRVE
YTAFEDGMHLIEVLYDDVAVPKSPFRVSVVEGCDPTRVRAYGPGLEGGVTNKANCFTVET
RGAGTGGLGLTVEGASESKMSCKDNKDGSCSVEYVPFTAGDYDVNITYGGHPIPGSPFRV
PVRDPVDPTKVKCSGPGLGSGVRAHVPQSFTVDCTKAGQAPLDVKLYGPTGTAEPVGVKN
NGDGTHTVHYTPGQDGPYSVAVKYADQEVPHSSPFKVKSQPGHDASKVRASGPGLDTKGV
SASIPVEFTIDAREAGEGLLTVQILXXXXXXXKASIQDNRDGTYTVSYVPDSVGNYTITI
KYGGDEIPYSPYRIKSLPTGDASKCLLTXXXXXXXXXGLQRLQTSEDTVITVDAKAAGKG
KVTCKVMTPEGAELDMDVVENHDGTFDIYYTAPEPGKYVITIRFGGQNIPKSPFHVVVSC
QASNEPVAPRDSVDPLFRPLNLVVPFTPQQGEITGEVRMPSGKTARPHITDNKDGTITVK
YQPAERGLHEMDIKYEGNHIPGSPMQFYVDATNSGIVTAYGPGLSYGMVNRASTFTVVTK
NAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYLPTVPGDYSVIVKFDNKHIPGSPFTAK
IAGDDAITRTSQLNVGTAADLSLKIAETDLSVLSASIRAPSGNEEPCLLKRLPNRHIGIS
FTPKEVGEHEVNVRKNGAHVANSPFKIMVGQSEIGDASRVKAFGKGLTEAHTFEMAEFFV
DTRNAGYGGLALSVEGPSKVDINCEDMEDGTCKVSYTPTEPGNYVVNIKFADKHIPGSPF
AVKMTGEGRMKESITTKRQASSIASVGSTCGLNLKIPGNWFQMVSAQERLTRTFTRSSHT
YTRTERTEISKTRGGETKREVRVEESTQHGGRGSPFRDVFGDFLGRESLSSFAGITARPE
XXXGGPQVMTAQVTSPKGKTTDADIVDGGGCSYSVRFIPQEMGPHTVNVKYRGQHVPGSP
FQFTVGPMGEGGAHKVHAGGTGLERGIAGNPSEFSIWTREAGAGGLSIAVEGPSKAEISF
EDRKDGSCGVSYVVKEPGDYEVSIKFNNEHIPDSPFVVPIATLSDEARRLTVTSLQEKDM
KVNQEASFMVQRNGARGVVDAKVHTPAGSAEECYVTELDSDKNTIRFIPRENGVHSIDVK
FNGCHIPGSPFNVRVGEPGQVGDPGMVSVHGPGLQGGITGVPAEFVVNTCNAGSGALAVN
IDGPSKVKMDCQECGEGYKVTYTPMAPGSYLIAIKYGGQQHIVGSPFKARVTGVRLSGGH
SLHETSSVLVETVTKSSKVGGAYSASSCSSSSSSLSSSAKLTSDASKVVCRGPGLSKALV
GQKNCFTVDCGKAGTNMLMVGVHGPRAPCEEVYVKHVGNKLYNVSYTVKEKGSYTVIVKW
GDDSVPGSPYKVSAP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]