dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

ENSGMOP00000009939 (Gadus morhua 69_1)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment pep:novel genescaffold:gadMor1:GeneScaffold_921:3:51941:1 gene:ENSGMOG00000009298 transcript:ENSGMOT00000010207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence length 1038
Sequence
AGPRLGAPVTLGISTLDPGLRPPAMPAGRRVTVRVRMLDDSEELFDVSQRAPGKVLFDLV
CTHMNLIEGDYFGLEFQDHHKMTVWLDLIKPLMKQLRRPKHTVLRFVVKFYPPDPAQLLE
ELTRYLFALQLKQDLSAGRLTCNDSSSALMVSHVVQSEIGDFEGSQSRSHLLNNNYIPDQ
MALMDRIMEFHSKNTGQTPAESDYQLLEVARRLEMYGVRQHPAKDREGTQLSLAASHTGV
LVFQGHTRINAFNWSKVRKLSFKRKRFLIKLRADLNSSYQDTLEFLMGSRDCCKVFWKIC
VEYHAFFRLFEEPKPKPKPVLFTRGSSFRFSGRTQKQVIDYVKESXXXXXXXXXKHSRVQ
HVCRLSPVPSPRRQEVPSEESALVTAEDPAPSXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVVSGGPQPAASPGAPRP
HALLNGQKHSLDLCGLSPDGRQPSPLTSPLLYDAGCVRTDDEDEVRRKRFPNDRAYFIAK
ELLTTERTYLKDLEVVSVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEGRSNAHIKGEYQHIGDVMLKNIQGLKPLTANLQRQAEALVDLDQACRSSRRLQDVC
RDFELQKVCYVPLNVFLLRPLHRLTHYKQILERFCKHYPPTHGDFRDCRAALADVTEVVE
QLRGSMLKMENFQKLLELKKDLIGIDNLVIPGRXXXXXXXXXXXXXXXXXXXXXXXFNDV
ILYTSRGMTATNQFKVHGQLPLHGMTIRESEDEWGVPNAFTLIGQQQSVVVAASSLSEME
KWMEDIKMAIDLAAETSNGPASDILSVDNKYPEDSSAEAESEDDLAAPRGPPEKPPPHRA
NTTVHVCWHRNTSVSMLDFSLAVENQLSGNLLRKFKNSNGWQKLWVVFTNFSLFFYKTHQ
DDYPLASLPLLGYSVTVPSEAENIHKDYVFKLHFKSHVYYFRSESEYTFERWMEVIRSAT
VPSSRTRIQNRKNETIPH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]