dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

orange1.1g024795m|PACid:18118492 (Citrus sinensis v154)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 262
Sequence
MEGNLGKIKVISDHFEVPTPSEDSPQINTPSASQPSTDGSLRSQLHSHSWTRRKLKSAAV
MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA
RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS
DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPS
TPNGSSENNCQICTWVKKTEIR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]