dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|428219411|ref|YP_007103876.1| (Pseudanabaena sp. PCC 7367)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment TonB family protein [Pseudanabaena sp. PCC 7367]
Sequence length 375
Sequence
MHRSSYCDRKRNEEMRLLLIVGLGSILSSTLFHMVVIAFGRLPDWRSSQSLDDENYIEIV
VVEPPAEDIPEVIEPPEITPEPPPLLVQPEIAAVPFVPEQPIIQESTPQPLEPNFDNLLQ
DLVPTDSAESSSVSVPVAPALPGNTFDPTKLIRVIAPKAPPVPPAPPAPPARRGSDRGGV
VCQNCPKPNYPRSARRDGVEGQPKVTFDVDENGKPTNIRIKNSSGNSELDQAAVEAVQEW
QLDPNSSSNAEDVSATINFELEGSQRQRRRRERDRRRRRREERTRPPEPVAAPANPAPDV
SNSVPEAPIATPEAPPENLLEGPASEPAAPAPVVPEQPETPAIEDTGTPAPVESAPAPIA
PPPPPPVEASESSSE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]