dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

DS10_00004867 (Drosophila suzukii)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Sequence length 1208
Sequence
MLDILSFTDCTGHPGHSGHTEYIQDIAQGDGSDYKERLIASVKKEVKQLMEEAVTKKYVH
EESSSVTSLCGAVEACLSQGLRRRALGLFKTSSTTALLHKIAKSCPEAEHISKMVQEIEA
SDPSKRSSSSSDSFQRPPMLKKSSSNSMSTGGSNAVATSSSASASASISVSASNSSMSLA
SMKYLWIRLALYEKRLTKIIEYLVSNASSFYDRDSLVADPDYGSILSSLLVGPCALEFTR
AKTADHYWTDPHADELVQRHRISSVRRSSSTCSRPAIINFKRSLNTSSDEASSGSFKSIA
SASVAKDYVESLHQNAKATLLYGKNNVQVLPKDVADPMPGYLSLHQHIQTLTIKWTPNQL
MNGYTEAEEAEDIDKDAFWAYALNINVDEIVYVHCHQSRGEDSGGTVILVGQDGVQRPPI
HFPEGGHMQQFLSCLETGLLPHGQLDPPLWSQRGIGKMFLWPRSMRRRILPSVMESVDET
PIDYVFRIVSKSRHEEFAATHSILDFVRSTPRRAQLSSCSTTGSSDCSNKSLSIDQFPLE
SPLLLQQQQQQLLQAQSTSIEMVCSTMRRQIISRAFYGWLAYCRHLSTVRTHLSGLVHGR
ITPEMKADEEGLTKERWQLLNVDGVLENATEFYRLVYFGGVQPELRQEVWPYLLGHYAFG
STSEERRKQDETCKHYYETTMSEWLAVDAIVQQREKEKTARAVAKLSSGSNSGNERTVRA
ADLEAGGELDNEVFEDISDISDPGDLEFDEQQQLQQQPVECPVSGNHLSVKPIPRAMKTS
TDSGHVDEGENFNELDEEQDEVEVEVEGSKAKKQLDHKKEPVPSAGSADDQEDQLNPEPS
CSTSTASSYETVGPGGGHQQPTSDTRSVLSPEYLSADDLQLPEDEDAVKPPPPPPPQATA
AVIITKASVDITHWERSSKLGEGDQMSPVEEQAGESVGGGGGVNLDALQQPKSACASPAS
SNGGVYSSELLEQFGLNLHRIEKDVQRCDRNYWYFANENLDKLRNVISTYVWEHLDVGYM
QGMCDLVAPLLVIFDDESLSYSCFCKFMERMIENFPSGGAMDMHFANMRSLIQILDSEMY
DLMDSNGDYTHFYFCYRWFLLDFKRELVYDDVFATWEVIWAAKHIASGHFVLFLALALLE
TYRDIILSNSMDFTDVIKFFNGKWIILKANFSINGRAPQCPIRAPVGPESGPPAADDHRK
QVECGRAG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]