dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

jCVI|EIN_039780 (Entamoeba invadens 1.2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment | organism=Entamoeba_invadens_IP1 | product=hypothetical protein | location=EINV_148:18221-19321(+) | length=366
Sequence length 366
Sequence
MNFTTSLKGNLEFVFKHSNHNIRFCGEVADLLDKLRSSRKEYCKSITKISQEFQKKLEDD
ALYGTTKEAVCQLLTSVLEEADGQMKTVEVLTNSIEEFKNKTKEIEKAAKGVRQDAETRT
KDVEKCKDATKKEKDKFVKCHKDVTSMLSDIEKSKTANAPEKKIKSLEEKRDHLKEKEEE
QNKVYVTSVETTNKRIKHFFDVDQIEILELYNKFEVNYLEQMKEILKNFSESLASIPVIV
KESMEKYNDKASHINSSEDVVTFCKIHKTSCRTPTYVPVIDADGLIIKQEGALNERRNDD
PEGMERVFLTCTVVHDFIAEGPEEMNVKKGDTIIVSEKHENGWWYATNKENATVGFVPET
FVKDVN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]