dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Esi0145_0040 (Ectocarpus siliculosus)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment BIG2, ArfGEF protein of the BIG/GBF family [2337] r:242626-272326
Sequence length 2336
Sequence
MVVAAEAGVHPPPTESDTGTNVSNNDDSSTGQPPSGGEDKLLLAMCRTIRKETGWQERTL
RQACDWATGELEQNQHPGVGMARYYRVVELAMGSKSEDVVEAALGQLHKLIAGGLVRRNT
MTTLKDGSSANLGEILVGVVMETGSRDKTVHGEELRKVALFVHETFLVIDSTANRARYNK
AQARATLDHILQEEPERSEGGEGGRRLDEVSLAGGSGGRRKGREAGAGRRGGGSPRLRVG
GDNVELTVVQRDALMLLSELCDWSLVDERTLSEELGGSGGGGGGGGEKESRVILESKTAA
LELIVSVLQTYGGPRFRALPAAATLVRGELCAALLHHCTSNITGLVSLSLRVFVALIKGF
KNHLKAEIEVFITSIFLRILESEHSAFDHKMLVLEVISGLCRDPLALVEMFINYDCDLQA
IDLFKRIATALAKVAKGRAGSEGASASKKDLEQDRSLQLMGMGGAVAMVSSMVKAADLEE
LYGDMAMVPRRGSASGALRRALVGLGCGVFTRKHESTGCRSCVTIEGEEDEGGADEERSV
DTTPVPSSPALSPLPLSGPLPLSSTWSGGAQRAKHALQRGYSLGGADGGFRATAAEGFED
EGPGRDRGSFRFDSAQVEAMHAFDTKRRVQGEIEAGIVKFNLKPKDGLAYLHSKGHLDSK
DPASVAAFLRAQADRLDKTEIGEFMGRGADHMGGFCVKVLHAYVDGIDFTDMEFDEAIRH
FLSGFRLPGEAQKIDRMMEKFAERFCLQNASVFPNPDTAFILAFSIVMLNTDLHNPSIPD
AKRMTKEGFIRNNRGIDQGKSLPDEFLGGVFDRIERSPISLKEDDQLRRKAEGGGSSATT
SLQELLPFAASAQSLRKLAEHDRERQEMLTSSRALLTRQRGHSSSTPTSYTHLSMEGRGE
GDSGWISQDIAEHVRLMHEITWGPLVSVFSEVLEASESPELIELCLDGVKKAVRIAGGLD
VPVARETLLNALVRFTLLDASRHMKDKNVRCAKVLLSLALTEGNLLKESWGLVLRCISQL
ARLQNTASRLQQDDNLFRVTAAASSNSSSVKGSNSKKQYEAAAAAAAAAAASAKAKRARR
ATTMTATAPSPRALQRGGGGGGGGGITEKAGEKDSAEANGKGGDADASAKQERRAKDSLS
ITLPESSLGSPKKKPSAAAAAAGGETTDWLSDLKIAFGVSTTTTTRKNGSSKDIKAVAGD
ETGTGEGDGGGSAGALDQVMSYVKERDAFLKDRRRKEKESAKGELASFFIGPSREEKERV
VEAANATVVMAQIDQALIDRVFSATQLLNREAMQHFVEQLIQVSQSEIPQLFGRRASTLG
NYQRQEGVLKGGAAKPRVFSMQKLVEVAHLNMDIRSRIEWASLWGILADHFGTVGSISGN
SSVAMYTVDCLRQLALKFLDKDELRDFNFQRVFLGPFATIVRTSRETAVRELVVSCLNNV
ILTKGTLLRSGWKTVLTVLRSAAADTQEEVVQPACLILEGLAGETFPLVQYDFVDLVYTL
LEMAASRFLDVSLVCIGHLRLCARQLAEGGVDVALQRPLPEATISNTGQLPPEVLGAVRA
DYGGGGGRGGGPGSDAGCSENSNTDVDDDDDVDEDRRSRRAARNDAVGHLTLDLDSLDPP
VPPDEAGGAVADPPAAAAAAVAVPTPTATGEDRAGRVSPSSDMWPSSARGKRGSNGVGGV
AAAEGGVGAAEQSRLALQLWWPLLTGLARGAGDPRLDCRAAALSTLQDVLKEFGSAPEFS
LRVWPYLLTRILLPVSRLAEKTTPPLAAPTAPAPPLVSAPSAPSTPSRHSRRQAQPATAT
PSALPSPGSGHLRLGPSSSLSAASGGRVPVARAAAATAAAPGPASRGVLPLDVDSWVHTT
APQLFRAAVAVVSSNAEAAVPLGVPTLLAFFEPHVCCRRHRHSTSNGSSSRFCSVSSNSR
QLGTGVAVNGGREGSGDEGESLARQEQRHQVQEDAGGGGEETGRWWDGEMQAAAAAGAAV
AEEAGVPGDGLMSRLALESLGLLVEGLAGHQQEKLPAAVLAHVCDSLLRMLRRCLPESFG
RAGRVGRDGSGGGGGRQPSQQRRRSRPPRPGLPADGDVHGAVGGKARGGVHSGSAAGPML
VVDDLLEWSGDGDDGPGGGGAAGWDGTALALEFLRREGGNLLVRYFVADGEVQRASLEDH
MWSSADDTAAAAAAAAVPSSSFAPPSPSQHRGGFSAESPSRHTVTSSSFSPTASTGSRAH
QQASTPRSVGSGGARRPLGAAPRLPAAGGLGPQHQQREPVNLVASAEAEVRHLTSAVLLL
LRGLLLLQPAEAFDREAGWLCPRLADLVVVRSLEVRAVVRELLTRMAPLIGVPGEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]