dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|343083748|ref|YP_004773043.1| (Cyclobacterium marinum DSM 745)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment glycine dehydrogenase [Cyclobacterium marinum DSM 745]
Sequence length 972
Sequence
MAAPKLIIFYLFMKINLASSEKFRNRHISPSENELQEMLNTIGVDSLDTLIDETIPSTIR
LKQPLQLPKPLSENLFLKSFKATIGKNQIFKSYIGLGYYDTLVPGVIQRNILENPGWYTA
YTPYQAEIAQGRLEALINFQTMVSELTGMELANASLLDEGTAAAEAMTMLYAAKARSKKK
ATTFYVDEKVFEQTKEILKTRATPIGITLKIGPLSDLDLSDPELFGILIQYPNSDGEIIN
YESLVNAAKEGHVSTAFSTDLLSLTLLKPPGEMGADVVIGSTQRFGVPMGFGGPHAAFFA
TKESFKRQIPGRIIGVSVDKSGKNAYRMALQTREQHIKRERATSNICTAQVLLAVMAGMY
AVYHGPKGLKAIASRTHGLAVMTAKWLSEIGFEQVNKAYFDTIRIKVDQVQKEKIRAFAV
SKKLNFRYDEGHILLSFDQAKTRQDVVEIFEVFAKSTNKLQPEVPEIPSQIDATIPSELE
RKSKFLEHEVFQKYHSEHEMLRYLKKLENKDLSLVHSMISLGSCTMKLNATTEMIPITWP
EIGQLHPFAPQDQAAGYYEMFQDLRNWLSEITGFSDTSLQPNSGAQGEYAGLMVIRAYHQ
SRNEDFRNVVLIPSSAHGTNPASAVMAGMKVVIVPCDEKGNIDVDAFKEKAATYKDQLSA
LMVTYPSTHGVFEEAIKEICDLVHEYGGQVYMDGANMNAQVGLTSPGLIGADVCHLNLHK
TFCIPHGGGGPGMGPICVAKHLVPFLPGNPYVKTGGTAAITPISAAPFGSSSILPIPYAY
IAMMGEEGLSKATKIAILNANYIKTRLGADFPILYTGANGRAAHEMILDCREFKAYGVEV
EDIAKRLMDYGFHAPTVSFPVPGTLMVEPTESESKDELDRFCEAMIAIRQEIREIEEGKA
DKLVNVLKNAPHTASSIISDSWDMPYSREKAAYPLPFVKENKFWPAVGRIDAAYGDRNLM
CSCIPTSDFENE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]