dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HGL_H00000216330-2 (Heterocephalus glaber v1.7-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment FKBP3 (Homo_sapiens) FK506 binding protein 3, 25kDa
Sequence length 224
Sequence
MAAAIPQRAWTVEQLRSEQLPKKDIIRFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLV
MAYNHLFETKRFKGTESVSKVTEQVKNVKLNEEKPKETKTEETLDEGPPKYTKSILKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLVFEVELVDID

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]