dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HGL_H00000357202-3 (Heterocephalus glaber v1.7-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment ISG20L2 (Homo_sapiens) interferon stimulated exonuclease gene 20kDa-like 2
Sequence length 185
Sequence
MSALLLNLDFAECPPKKSLEGNAKHRNFVKRQQFLEQRGFLNKKNQCPSKPCPIVDYRTR
WSGIRKHHMLKATPFKTAWSQILKILSGKVVVGHANHNDFKAPQYFHPKPLTRDTSQIPL
LNRKASCPENATMSLKTLTKKLLGWDIQAGKSGHSSVEDAQATMELYKLVEVEWEHHLAQ
NLQKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]