dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HGL_H00000369649-2 (Heterocephalus glaber v1.7-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment HSP90AA4P (Homo_sapiens) heat shock protein 90kDa alpha (cytosolic), class A member 4 (pseudogene)
Sequence length 214
Sequence
MKENQKHIYYITGETKEQVANSAFMERLRKHGLEVIHMIEPINEYCIQQLKEFEGEALGS
VTKEGLELSEDEEEKKKQKEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSK
YGWTANMERIMKVQALRDNSTMGYMTAKKHLEINPDHSITETLRQKAEADKNKSVKDLVI
LLYETALLSSDFSLEDPPDTRQQNLQDDQAGAHY

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]