dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

HGL_M00000062995-1 (Heterocephalus glaber v1.7-2)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment Dnahc10 (Mus_musculus) dynein, axonemal, heavy chain 10 Gene
Sequence length 684
Sequence
MARILLLFLPGLVAVCAGHGVFMDRLASKKLCADDECVYTISLARAQEDYNAPDCRFINV
KKGQQIYVYSKLVKENEAGEFWAGSVYGDHQTEMGIVGYFPSSLVKEQRVYQEATKEVLT
TAVALMEEFQGLDRDIEGSAKQWRKWVESECPEKEKLPQEWKKKNLIQKLIILRAVRPDR
MTYALRNFVEEKLGAKYVERTRLDLGKALEESSPATPVFFILSPGVDALKDLEMLGKRLG
FTIDSGKFYNVSLGQGQEKVAETALEKASRRGHWVILQNVHLVAKWLGTLEKLLEGFSQG
SHEDFRVFMSAESAPTPDEHIIPQGLLENSIKITNEPPTGMLANLHAALYNFNQDTLEIC
TKEQEFKSILFSLCYFHACVAGRLRFGSQGWSRSYPFNPGDLTICANVLYNYLEANPNVP
WEDLRYLFGEIMYGGHITDVWDRRLCQVYLEEFMNPSLIEDELMLAPGFAAPPYLDYSGY
HQYIEEMLPPESPALLVLEDIHFTKKHFYFFSYLRLTRFNDLLLRCRELDTWTQDLVLPA
VVWLSGFFNPQSFLTAIMQSMARKNEWPLDRMCLTVDVTKKVKEDYSHPPREGAYLHGLS
MEGARWDIQSGTIVQARLKELTSTMPVIFAKAIPMDRQETRQTYECPVYKNKMRGSTYIW
TFRLKSKEKTAKWVLAGVALLLEA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]