dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

gi|310118526|ref|XP_001130065.3| (Homo sapiens )

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment PREDICTED: PRAME family member 23 [Homo sapiens]
Sequence length 557
Sequence
MCFRHVLTVSGKTKVTQLGAGLGENADLASIKPSGTCFLDSEMEPEERPKVFKPRVPAWF
FLRTEHLLDYIQICFPCRFVKMSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPL
FMEAFSRRRCEALKLMVQAWPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVHPRRWK
LQVLDLQDVCENFWMVWSEAMAHGCFLNAKRNKKPVQDCPRMRGQQPLTVFVELWLKNRT
LDEYLTCLLLWVKQRKDLLHLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLP
ILTQFTPYLGHMRNLQKLVLSHMDVSRYVSPEQKKEIVTQFTTQFLKLCCLQKLSMNSVS
FLEGHLDQLLSCLKTSLKVLTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLV
PLQILLEKVAATLEYLDLDDCGIIDSQVNAILPALSCCFELNTFSFCGNPISMATLENLL
SHTIILKNLCVELYPAPRESYDADGTLCWSRFPQIRAELMKRVRDLRHPKRILFCTDCCP
DCGNRSFYDLEADQCCC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]